PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN36595.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 324aa    MW: 36130.5 Da    PI: 6.3063
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN36595.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd+ll ++++ +G+g+W+tI++  g+ R++k+c++rw +yl
       KHN36595.1 14 KGPWTSEEDLLLTNYIQTHGPGNWRTIPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.65.1e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
       KHN36595.1  67 RGRFSFEEEEAIIQLHSVLGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.089961IPR017930Myb domain
SuperFamilySSF466892.62E-3111108IPR009057Homeodomain-like
SMARTSM007172.9E-141363IPR001005SANT/Myb domain
PfamPF002491.9E-161461IPR001005SANT/Myb domain
CDDcd001674.11E-121661No hitNo description
PROSITE profilePS5129425.24462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2665116IPR009057Homeodomain-like
SMARTSM007171.8E-1666114IPR001005SANT/Myb domain
PfamPF002492.6E-1567111IPR001005SANT/Myb domain
CDDcd001671.48E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGRAPCCDKN GLKKGPWTSE EDLLLTNYIQ THGPGNWRTI PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEEAIIQ LHSVLGNKWS AIAARLPGRT DNEIKNYWNT HVRKRLLRTG  120
IDPVTHAPRL DLLDISSILR SAIGNVNPSI LNLQGLLGAQ ALMNPEFLKL AATATLLSLK  180
NNENPSNLVS QVQQQFNSAG NCLVQNQVAA PNDPFQTPTH VNNGLSSSSP ENSILSHLGE  240
NNNYQLNAQQ INQVDLLLDH ELEHYLNCVN QNIGYESVTP LSTPTPLNSS STYVNSSTEE  300
ERDTYCSDIF KLEIPESLDI SDFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-29121162105C-Myb DNA-Binding Domain
1msf_C1e-29121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150405e-48AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006595453.10.0PREDICTED: transcription factor MYB57-like
TrEMBLA0A0B2RU610.0A0A0B2RU61_GLYSO; Transcription factor MYB39
TrEMBLI1M3Y20.0I1M3Y2_SOYBN; Uncharacterized protein
STRINGGLYMA13G37820.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28110.18e-85myb domain protein 41
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]